Resumo: Colibacilose enterotoxigênica ocorre em leitões recém-nascidos e porcos no pósdesmame. Um dos fatores de virulência de E. coli é a presença de antígenos de aderência, muitas vezes estruturas do tipo fimbria, que permite a ligação da bactéria às células do hospedeiro. Em 1986, Yano et ai. descreveram uma nova adesina, chamada de F42. Este trabalho tem por objetivo a caracterização bioquímica desta fimbria a nível molecular e comparar sua estrutura primária com a da fimbria F41, a fim de diferenciá-Ias. Assim, a fimbria F42 foi extraída e purificada através de cromatografia em coluna de gel filtração Sepharose CL 4B, equilibrada com tampão Tris-HCI O,O25M com NaCI O,15M, pH 7,4; apresentando massa molecular aparente de 16 kDa. Foi feita a análise da composição de aminoácidos da proteína, demonstrando a presença de aproximadamente 145 resíduos em uma única cadeia e mostrando diferenças com a fimbria F41. Fez-se, também, sua redução e carboximetilação, digestão com brometo de cianogênio, separação dos peptídeos através de cromatografia em coluna de fase reversa Cs e obtenção de peptídeos menores com a fimbria submetida à ação de tripsina tratada com N-tosil-Lfenilalanilclorometil cetona (TPCK). Os peptídeos resultantes da digestão foram separados através de cromatografia em coluna de fase reversa CIs. Foi feita nova digestão com CNBr e os peptídeos separados e purificados em coluna Superdex Peptide e foi feita a análise da composição de aminoácidos dos peptídeos. Foi feita a extração do DNA plasmidiano e PCR da amostra padrão. Foram feitas, também, digestões com Tripsina e Endoproteinase Asp-N, separação em cromatografia de fase reversa, análise da composição de aminoácidos de alguns peptídeos e sequenciamento de aminoácidos destes peptídeos e da porção Nterminal até o 32° resíduo, com o seguinte resultado: aswtegqpgdiiiggeitspsvkwlwktgegl Tentou-se, ainda, o sequenciamento da porção C-terminal com carboxipeptidase Y. Ver menos

Abstract: Enterotoxigenic colibacillosis occurs in newborn piglets and weaned pigs. One of the factors of virulence of E. coli is the presence of antigens of adherence, often fimbria type structure, that allow the connection of the bacteria to the cells of the host. In 1986, Yano et al. described a new adesin, denominated of F42. This work aims the biochemical characterization of this fimbria at molecular level and to compare their primary structure to the fimbria F41, in order to distinguish them. Thus, the fimbria F42 was extracted and purified through chromatography of gel filtration in Sepharose CL 4B equilibrated with lid Tris-HCI O,O25M with NaCI O,15M, pH 7,4, presented a molecular mass apparent of 16kDa. It was performed the analysis of the amino acids composition of the protein, and was demonstrated the presence of 145 residues e showing differences with F41 fimbria. It was made their reduction, carboximetilation, cianogen bromide digestion, separation of the peptides through of reverse phase chromatography Cs and obtaining of smaller peptides with the fimbria subject to the action of tripsin treated with N-tosil-L-phenylalanilc1orometil ketone (TPCK). The resulting peptides of the digestion were separate through reverse phase chromatography CIs. It was undergone digestion with CNBr and the separate peptides and purified in Superdex Peptide column and it was made the analysis of the composition of amino acids of the peptides. They were made the extraction of the plasmidial DNA and PCR of the sample standard. They were done, also, digestions with Tripsin and Endoproteinase Asp-N, separation in reverse phase chromatography, analysis of the composition of amino acids of some peptides and sequencing of amino acids of these peptides and of the portion N-terminal to the 32nd residue, presenting these results: aswtegqpgdiiiggeitspsvkwlwktgeg. The sequencing of the portion C-terminal was tried with carboxipeptidase Y. Ver menos